PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G136600.1.p
Common NameSb03g011640, SORBIDRAFT_03g011640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 428aa    MW: 47480.9 Da    PI: 6.828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G136600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
  Sobic.003G136600.1.p 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
                          678*******************************************97 PP

2Myb_DNA-binding47.15.5e-1567109145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           rg++++eE++l++++++ lG++ W+ Ia +++ gRt++++k+ w+
  Sobic.003G136600.1.p  67 RGAFSQEEEDLIIELHAVLGNR-WSQIATRLP-GRTDNEIKNLWN 109
                           89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.396961IPR017930Myb domain
SuperFamilySSF466891.83E-2912108IPR009057Homeodomain-like
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002495.5E-151461IPR001005SANT/Myb domain
CDDcd001671.15E-101761No hitNo description
PROSITE profilePS5129425.16762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-2565116IPR009057Homeodomain-like
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
PfamPF002498.8E-1467109IPR001005SANT/Myb domain
CDDcd001671.09E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIE LHAVLGNRWS QIATRLPGRT DNEIKNLWNS SIKKKLRQKG  120
IDPNTHKPLA EVEHSKAAPT ISTERTSESS DVDPSSGGAL GNLSHLLSET AQSPELLPVL  180
GKHRKETTSL AHLRVPPKEL FLDQLVSGHE NLTSCRSTGP IPNFPFQQLM CYNNEFGHKN  240
GGSNNSFWFN QNESSGSTIS TVMPPVSPST LSTSTGLNGS PDNPHSGGTG IQNTQFYWET  300
ANPSSSSSRG SSGSNSLGFE RQSTSSLLES SVFPWTDLTP DKNSQVHLEE ELKWPDLLHG  360
TFTDTPATMQ NLSQSLYEDV IKAESQFNIE GLCAAWSQNL QPQQHLQVVS DLYDKDLQRM  420
SLSFENI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.25890.0callus| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269010.0KJ726901.1 Zea mays clone pUT3446 MYB transcription factor (MYB128) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457686.10.0hypothetical protein SORBIDRAFT_03g011640
TrEMBLC5XHY70.0C5XHY7_SORBI; Putative uncharacterized protein Sb03g011640
STRINGSb03g011640.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-91myb domain protein 61